SCOP 1.71: Domain d1xm4b_: 1xm4 B:

Lineage for d1xm4b_ (1xm4 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam 00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)

8. Domain d1xm4b_: 1xm4 B: [115466]
   complexed with mg, pil, zn

Details for d1xm4b_

PDB Entry: 1xm4, 2.31 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Piclamilast

SCOP Domain Sequences for d1xm4b_:

Sequence; same for both SEQRES and ATOM records:

>d1xm4b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens)}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

Timeline for d1xm4b_:

• d1xm4b_ is new in SCOP 1.71
  
• d1xm4b_ appears in SCOP 1.73
  
• d1xm4b_ appears in the current release, SCOPe 2.08