SCOPe 2.05: Domain d1xm3b_: 1xm3 B:

Lineage for d1xm3b_ (1xm3 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.31: ThiG-like [110399] (2 families)
   shares the common phosphate-binding site with other superfamilies

5. Family c.1.31.1: ThiG-like [110400] (1 protein)
   Pfam PF05690

6. Protein Thiazole biosynthesis protein ThiG [110401] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [110402] (2 PDB entries)
   Uniprot O31618

8. Domain d1xm3b_: 1xm3 B: [115462]
   Structural genomics target

Details for d1xm3b_

PDB Entry: 1xm3, 1.8 Å

PDB Description: Crystal structure of Northeast Structural Genomics Target SR156

PDB Compounds: (B:) Thiazole biosynthesis protein thiG

SCOPe Domain Sequences for d1xm3b_:

Sequence; same for both SEQRES and ATOM records:

>d1xm3b_ c.1.31.1 (B:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
smltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleql
dlskytllpntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseq
lleegfivlpytsddvvlarkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpv
ivdagigspkdaayamelgadgvllntavsgaddpvkmaramklaveagrlsyeagripl
kqygtasspge

Timeline for d1xm3b_:

• d1xm3b_ first appeared in SCOP 1.71
  
• d1xm3b_ appears in SCOPe 2.04
  
• d1xm3b_ appears in SCOPe 2.06
  
• d1xm3b_ appears in the current release, SCOPe 2.08