SCOPe 2.07: Domain d1xlyb_: 1xly B:

Lineage for d1xlyb_ (1xly B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.232: RNA-binding protein She2p [116941] (1 superfamily)
   5 helices; bundle, closed, left-handed twist; topological similarity to the middle domain of the L-aspartase-like fold (48556)

4. Superfamily a.232.1: RNA-binding protein She2p [116942] (1 family)
   automatically mapped to Pfam PF11435

5. Family a.232.1.1: RNA-binding protein She2p [116943] (1 protein)

6. Protein RNA-binding protein She2p [116944] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116945] (1 PDB entry)
   Uniprot P36068 6-237

8. Domain d1xlyb_: 1xly B: [115458]

Details for d1xlyb_

PDB Entry: 1xly, 1.95 Å

PDB Description: x-ray structure of the rna-binding protein she2p

PDB Compounds: (B:) SHE2p

SCOPe Domain Sequences for d1xlyb_:

Sequence, based on SEQRES records:

>d1xlyb_ a.232.1.1 (B:) RNA-binding protein She2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tselveqilallsrylssyihvlnkfishlrrvatlrferttlikfvkklrfyndsvlsy
nasefinegkneldpeadsfdkvilpiasmfvksvetfdllnyyltqslqkeilsktlne
dltltaesilaiddtynhfvkfsqwmieslrigsnlldlevvqfaiksadedgtnigetd
niflqeilpvnseeefqtlsaawhsildgklsaldeefdvvatkw

Sequence, based on observed residues (ATOM records):

>d1xlyb_ a.232.1.1 (B:) RNA-binding protein She2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tselveqilallsrylssyihvlnkfishlrrvatlrferttlikfvkklrfyndsvlsy
nasefdkvilpiasmfvksvetfdllnyyltqslqkeilsktlnedltltaesilaiddt
ynhfvkfsqwmieslrigsnlldlevvqfaseeefqtlsaawhsildgklsaldeefdvv
atkw

Timeline for d1xlyb_:

• d1xlyb_ first appeared in SCOP 1.71
  
• d1xlyb_ appears in SCOPe 2.06
  
• d1xlyb_ appears in the current release, SCOPe 2.08