Lineage for d1xlyb_ (1xly B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546344Fold a.232: RNA-binding protein She2p [116941] (1 superfamily)
    5 helices; bundle, closed, left-handed twist; topological similarity to the middle domain of the L-aspartase-like fold (scop_cf 48556)
  4. 546345Superfamily a.232.1: RNA-binding protein She2p [116942] (1 family) (S)
  5. 546346Family a.232.1.1: RNA-binding protein She2p [116943] (1 protein)
  6. 546347Protein RNA-binding protein She2p [116944] (1 species)
  7. 546348Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116945] (1 PDB entry)
  8. 546350Domain d1xlyb_: 1xly B: [115458]
    mutant

Details for d1xlyb_

PDB Entry: 1xly (more details), 1.95 Å

PDB Description: x-ray structure of the rna-binding protein she2p

SCOP Domain Sequences for d1xlyb_:

Sequence, based on SEQRES records: (download)

>d1xlyb_ a.232.1.1 (B:) RNA-binding protein She2p {Baker's yeast (Saccharomyces cerevisiae)}
tselveqilallsrylssyihvlnkfishlrrvatlrferttlikfvkklrfyndsvlsy
nasefinegkneldpeadsfdkvilpiasmfvksvetfdllnyyltqslqkeilsktlne
dltltaesilaiddtynhfvkfsqwmieslrigsnlldlevvqfaiksadedgtnigetd
niflqeilpvnseeefqtlsaawhsildgklsaldeefdvvatkw

Sequence, based on observed residues (ATOM records): (download)

>d1xlyb_ a.232.1.1 (B:) RNA-binding protein She2p {Baker's yeast (Saccharomyces cerevisiae)}
tselveqilallsrylssyihvlnkfishlrrvatlrferttlikfvkklrfyndsvlsy
nasefdkvilpiasmfvksvetfdllnyyltqslqkeilsktlnedltltaesilaiddt
ynhfvkfsqwmieslrigsnlldlevvqfaseeefqtlsaawhsildgklsaldeefdvv
atkw

SCOP Domain Coordinates for d1xlyb_:

Click to download the PDB-style file with coordinates for d1xlyb_.
(The format of our PDB-style files is described here.)

Timeline for d1xlyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xlya_