Lineage for d1xlyb_ (1xly B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015738Fold a.232: RNA-binding protein She2p [116941] (1 superfamily)
    5 helices; bundle, closed, left-handed twist; topological similarity to the middle domain of the L-aspartase-like fold (48556)
  4. 2015739Superfamily a.232.1: RNA-binding protein She2p [116942] (1 family) (S)
    automatically mapped to Pfam PF11435
  5. 2015740Family a.232.1.1: RNA-binding protein She2p [116943] (1 protein)
  6. 2015741Protein RNA-binding protein She2p [116944] (1 species)
  7. 2015742Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116945] (1 PDB entry)
    Uniprot P36068 6-237
  8. 2015744Domain d1xlyb_: 1xly B: [115458]

Details for d1xlyb_

PDB Entry: 1xly (more details), 1.95 Å

PDB Description: x-ray structure of the rna-binding protein she2p
PDB Compounds: (B:) SHE2p

SCOPe Domain Sequences for d1xlyb_:

Sequence, based on SEQRES records: (download)

>d1xlyb_ a.232.1.1 (B:) RNA-binding protein She2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tselveqilallsrylssyihvlnkfishlrrvatlrferttlikfvkklrfyndsvlsy
nasefinegkneldpeadsfdkvilpiasmfvksvetfdllnyyltqslqkeilsktlne
dltltaesilaiddtynhfvkfsqwmieslrigsnlldlevvqfaiksadedgtnigetd
niflqeilpvnseeefqtlsaawhsildgklsaldeefdvvatkw

Sequence, based on observed residues (ATOM records): (download)

>d1xlyb_ a.232.1.1 (B:) RNA-binding protein She2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tselveqilallsrylssyihvlnkfishlrrvatlrferttlikfvkklrfyndsvlsy
nasefdkvilpiasmfvksvetfdllnyyltqslqkeilsktlnedltltaesilaiddt
ynhfvkfsqwmieslrigsnlldlevvqfaseeefqtlsaawhsildgklsaldeefdvv
atkw

SCOPe Domain Coordinates for d1xlyb_:

Click to download the PDB-style file with coordinates for d1xlyb_.
(The format of our PDB-style files is described here.)

Timeline for d1xlyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xlya_