Lineage for d1xlxb_ (1xlx B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546038Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 546039Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) (S)
  5. 546057Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam 00233; multihelical; can be divided into three subdomains
  6. 546061Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 546062Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)
  8. 546083Domain d1xlxb_: 1xlx B: [115456]
    complexed with cio, mg, zn

Details for d1xlxb_

PDB Entry: 1xlx (more details), 2.19 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Cilomilast

SCOP Domain Sequences for d1xlxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlxb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens)}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

SCOP Domain Coordinates for d1xlxb_:

Click to download the PDB-style file with coordinates for d1xlxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xlxb_: