![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries) Uniprot O35627 109-358 |
![]() | Domain d1xlsg_: 1xls G: [115453] Other proteins in same PDB: d1xlsa_, d1xlsb_, d1xlsc_, d1xlsd_ complexed with 9cr, tcd |
PDB Entry: 1xls (more details), 2.96 Å
SCOPe Domain Sequences for d1xlsg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlsg_ a.123.1.1 (G:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei cs
Timeline for d1xlsg_: