Lineage for d1xlsg_ (1xls G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728789Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 2728795Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
    Uniprot O35627 109-358
  8. 2728800Domain d1xlsg_: 1xls G: [115453]
    Other proteins in same PDB: d1xlsa_, d1xlsb_, d1xlsc_, d1xlsd_
    complexed with 9cr, tcd

Details for d1xlsg_

PDB Entry: 1xls (more details), 2.96 Å

PDB Description: crystal structure of the mouse car/rxr lbd heterodimer bound to tcpobop and 9cra and a tif2 peptide containg the third lxxll motifs
PDB Compounds: (G:) Orphan nuclear receptor NR1I3

SCOPe Domain Sequences for d1xlsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlsg_ a.123.1.1 (G:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]}
nqqqkelvqillgahtrhvgplfdqfvqfrppaylfmhhrpfqprgpvlpllthfadint
fmvqqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykm
edavhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqe
emalilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgei
cs

SCOPe Domain Coordinates for d1xlsg_:

Click to download the PDB-style file with coordinates for d1xlsg_.
(The format of our PDB-style files is described here.)

Timeline for d1xlsg_: