Lineage for d1xlsd_ (1xls D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342369Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2342370Species Human (Homo sapiens) [TaxId:9606] [48511] (39 PDB entries)
    Uniprot P19793 227-458
  8. 2342439Domain d1xlsd_: 1xls D: [115450]
    Other proteins in same PDB: d1xlse_, d1xlsf_, d1xlsg_, d1xlsh_
    complexed with 9cr, tcd

Details for d1xlsd_

PDB Entry: 1xls (more details), 2.96 Å

PDB Description: crystal structure of the mouse car/rxr lbd heterodimer bound to tcpobop and 9cra and a tif2 peptide containg the third lxxll motifs
PDB Compounds: (D:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1xlsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlsd_ a.123.1.1 (D:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1xlsd_:

Click to download the PDB-style file with coordinates for d1xlsd_.
(The format of our PDB-style files is described here.)

Timeline for d1xlsd_: