![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48511] (34 PDB entries) Uniprot P19793 227-458 |
![]() | Domain d1xlsd_: 1xls D: [115450] Other proteins in same PDB: d1xlse_, d1xlsf_, d1xlsg_, d1xlsh_ complexed with rea, tcd |
PDB Entry: 1xls (more details), 2.96 Å
SCOPe Domain Sequences for d1xlsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xlsd_ a.123.1.1 (D:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
Timeline for d1xlsd_: