SCOP 1.71: Domain d1xlsc_: 1xls C:

Lineage for d1xlsc_ (1xls C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48512] (2 PDB entries)

8. Domain d1xlsc_: 1xls C: [115449]
   Other proteins in same PDB: d1xlse_, d1xlsf_, d1xlsg_, d1xlsh_

Details for d1xlsc_

PDB Entry: 1xls, 2.96 Å

PDB Description: crystal structure of the mouse car/rxr lbd heterodimer bound to tcpobop and 9cra and a tif2 peptide containg the third lxxll motifs

SCOP Domain Sequences for d1xlsc_:

Sequence; same for both SEQRES and ATOM records:

>d1xlsc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus)}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Timeline for d1xlsc_:

• d1xlsc_ is new in SCOP 1.71
  
• d1xlsc_ appears in SCOP 1.73
  
• d1xlsc_ appears in the current release, SCOPe 2.08