SCOP 1.73: Domain d1xlsa_: 1xls A:

Lineage for d1xlsa_ (1xls A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48512] (2 PDB entries)

8. Domain d1xlsa_: 1xls A: [115447]
   Other proteins in same PDB: d1xlse_, d1xlsf_, d1xlsg_, d1xlsh_

Details for d1xlsa_

PDB Entry: 1xls, 2.96 Å

PDB Description: crystal structure of the mouse car/rxr lbd heterodimer bound to tcpobop and 9cra and a tif2 peptide containg the third lxxll motifs

PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOP Domain Sequences for d1xlsa_:

Sequence; same for both SEQRES and ATOM records:

>d1xlsa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus) [TaxId: 10090]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Timeline for d1xlsa_:

• d1xlsa_ first appeared in SCOP 1.71
  
• d1xlsa_ appears in SCOP 1.75
  
• d1xlsa_ appears in the current release, SCOPe 2.08