Lineage for d1xlsa_ (1xls A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543673Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 543703Species Mouse (Mus musculus) [TaxId:10090] [48512] (2 PDB entries)
  8. 543705Domain d1xlsa_: 1xls A: [115447]
    Other proteins in same PDB: d1xlse_, d1xlsf_, d1xlsg_, d1xlsh_

Details for d1xlsa_

PDB Entry: 1xls (more details), 2.96 Å

PDB Description: crystal structure of the mouse car/rxr lbd heterodimer bound to tcpobop and 9cra and a tif2 peptide containg the third lxxll motifs

SCOP Domain Sequences for d1xlsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xlsa_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Mouse (Mus musculus)}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d1xlsa_:

Click to download the PDB-style file with coordinates for d1xlsa_.
(The format of our PDB-style files is described here.)

Timeline for d1xlsa_: