SCOP 1.71: Domain d1xl7b1: 1xl7 B:11-392

Lineage for d1xl7b1 (1xl7 B:11-392)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam 00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)

8. Domain d1xl7b1: 1xl7 B:11-392 [115440]

Details for d1xl7b1

PDB Entry: 1xl7, 2 Å

PDB Description: crystal structure of mouse carnitine octanoyltransferase

SCOP Domain Sequences for d1xl7b1:

Sequence; same for both SEQRES and ATOM records:

>d1xl7b1 c.43.1.3 (B:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus)}
ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
ynlisfangifgcccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
tvdekilndvsqakaqhlkaas

Timeline for d1xl7b1:

• d1xl7b1 is new in SCOP 1.71
  
• d1xl7b1 appears in SCOP 1.73
  
• d1xl7b1 appears in the current release, SCOPe 2.08