Lineage for d1xl7a2 (1xl7 A:393-610)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 832925Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 832926Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 833001Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 833049Protein Peroxisomal carnitine O-octanoyltransferase, COT [117575] (1 species)
  7. 833050Species Mouse (Mus musculus) [TaxId:10090] [117576] (4 PDB entries)
    Uniprot Q9DC50 11-612
  8. 833052Domain d1xl7a2: 1xl7 A:393-610 [115439]

Details for d1xl7a2

PDB Entry: 1xl7 (more details), 2 Å

PDB Description: crystal structure of mouse carnitine octanoyltransferase
PDB Compounds: (A:) Peroxisomal carnitine O-octanoyltransferase

SCOP Domain Sequences for d1xl7a2:

Sequence, based on SEQRES records: (download)

>d1xl7a2 c.43.1.3 (A:393-610) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
dlqiaastftsfgkkltkeealhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrt
etvrsctveavrwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllglll
iakeeglpvpelfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirdd
rfvvacsswrscpetdaeklvqmifhafhdmiqlmnta

Sequence, based on observed residues (ATOM records): (download)

>d1xl7a2 c.43.1.3 (A:393-610) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]}
dlqiaastftlhpdtfiqlalqlayyrlhgrpgccyetamtryfyhgrtetvrsctveav
rwcqsmqdpsasllerqqkmleafakhnkmmkdcshgkgfdrhllgllliakeeglpvpe
lfedplfsrsggggnfvlstslvgylrvqgvvvpmvhngygffyhirddrfvvacsswrs
cpetdaeklvqmifhafhdmiqlmnta

SCOP Domain Coordinates for d1xl7a2:

Click to download the PDB-style file with coordinates for d1xl7a2.
(The format of our PDB-style files is described here.)

Timeline for d1xl7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xl7a1