SCOPe 2.08: Domain d1xl7a1: 1xl7 A:11-392

Lineage for d1xl7a1 (1xl7 A:11-392)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Peroxisomal carnitine O-octanoyltransferase, COT, N-terminal domain [418986] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [419458] (4 PDB entries)
   Uniprot Q9DC50

8. Domain d1xl7a1: 1xl7 A:11-392 [115438]
   Other proteins in same PDB: d1xl7a2, d1xl7b2
   complexed with epe, mpd
   has additional insertions and/or extensions that are not grouped together

Details for d1xl7a1

PDB Entry: 1xl7, 2 Å

PDB Description: crystal structure of mouse carnitine octanoyltransferase

PDB Compounds: (A:) Peroxisomal carnitine O-octanoyltransferase

SCOPe Domain Sequences for d1xl7a1:

Sequence; same for both SEQRES and ATOM records:

>d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ertfqyqdslpslpvpaleeslkkylesvkpfanedeykkteeivqkfqegagkrlhqkl
lerargkrnwleewwlnvayldvripsqlnvnfvgpcphfehywparegtqlergsmmlw
hnlnywqllrreklpvhksgntpldmnqfrmlfstckvpgitrdsimnyfkteseghcpt
hiavlcrgrafvfdvlhegclitppellrqltyihkkcsnepvgpsiaaltseertrwak
areylisldpenltllekiqtslfvysiedssphatpeeysqvfemllggdpsvrwgdks
ynlisfangifgcccdhapydamvmvniahyvdervletegrwkgsekvrdiplpeelvf
tvdekilndvsqakaqhlkaas

Timeline for d1xl7a1:

• d1xl7a1 first appeared in SCOP 1.71
  
• d1xl7a1 appears in SCOPe 2.07