![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
![]() | Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species) |
![]() | Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries) Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690 |
![]() | Domain d1xl6b1: 1xl6 B:139-299 [115436] Other proteins in same PDB: d1xl6a2, d1xl6b2 complexed with k, mg, spm |
PDB Entry: 1xl6 (more details), 2.85 Å
SCOPe Domain Sequences for d1xl6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xl6b1 b.1.18.16 (B:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh
Timeline for d1xl6b1: