Lineage for d1xl6a2 (1xl6 A:23-138)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1696876Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1696877Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1696878Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1696883Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 1696884Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 1696889Domain d1xl6a2: 1xl6 A:23-138 [115435]
    Other proteins in same PDB: d1xl6a1, d1xl6b1
    complexed with k, mg, spm

Details for d1xl6a2

PDB Entry: 1xl6 (more details), 2.85 Å

PDB Description: Intermediate gating structure 2 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (A:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl6a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

SCOPe Domain Coordinates for d1xl6a2:

Click to download the PDB-style file with coordinates for d1xl6a2.
(The format of our PDB-style files is described here.)

Timeline for d1xl6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xl6a1