Lineage for d1xl6a2 (1xl6 A:23-138)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023604Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 3023605Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 3023610Domain d1xl6a2: 1xl6 A:23-138 [115435]
    Other proteins in same PDB: d1xl6a1, d1xl6a3, d1xl6b1, d1xl6b3
    complexed with k, mg, spm

Details for d1xl6a2

PDB Entry: 1xl6 (more details), 2.85 Å

PDB Description: Intermediate gating structure 2 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (A:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl6a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

SCOPe Domain Coordinates for d1xl6a2:

Click to download the PDB-style file with coordinates for d1xl6a2.
(The format of our PDB-style files is described here.)

Timeline for d1xl6a2: