Lineage for d1xl4b2 (1xl4 B:23-138)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629062Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 2629063Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 2629065Domain d1xl4b2: 1xl4 B:23-138 [115433]
    Other proteins in same PDB: d1xl4a1, d1xl4a3, d1xl4b1, d1xl4b3
    complexed with k, mg

Details for d1xl4b2

PDB Entry: 1xl4 (more details), 2.6 Å

PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (B:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl4b2 f.14.1.1 (B:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

SCOPe Domain Coordinates for d1xl4b2:

Click to download the PDB-style file with coordinates for d1xl4b2.
(The format of our PDB-style files is described here.)

Timeline for d1xl4b2: