Lineage for d1xl4b2 (1xl4 B:23-138)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956602Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 1956603Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1956604Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1956609Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 1956610Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
    Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690
  8. 1956612Domain d1xl4b2: 1xl4 B:23-138 [115433]
    Other proteins in same PDB: d1xl4a1, d1xl4b1
    complexed with k, mg

Details for d1xl4b2

PDB Entry: 1xl4 (more details), 2.6 Å

PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (B:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl4b2 f.14.1.1 (B:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

SCOPe Domain Coordinates for d1xl4b2:

Click to download the PDB-style file with coordinates for d1xl4b2.
(The format of our PDB-style files is described here.)

Timeline for d1xl4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xl4b1