Lineage for d1xl4b1 (1xl4 B:139-299)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552493Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (3 proteins)
  6. 552501Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)
  7. 552502Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (2 PDB entries)
  8. 552504Domain d1xl4b1: 1xl4 B:139-299 [115432]
    Other proteins in same PDB: d1xl4a2, d1xl4b2
    complexed with k, mg

Details for d1xl4b1

PDB Entry: 1xl4 (more details), 2.6 Å

PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1

SCOP Domain Sequences for d1xl4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl4b1 b.1.18.16 (B:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

SCOP Domain Coordinates for d1xl4b1:

Click to download the PDB-style file with coordinates for d1xl4b1.
(The format of our PDB-style files is described here.)

Timeline for d1xl4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xl4b2