SCOPe 2.08: Domain d1xl4b1: 1xl4 B:139-295

Lineage for d1xl4b1 (1xl4 B:139-295)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d1xl4b1: 1xl4 B:139-295 [115432]
   Other proteins in same PDB: d1xl4a2, d1xl4a3, d1xl4b2, d1xl4b3
   complexed with k, mg

Details for d1xl4b1

PDB Entry: 1xl4, 2.6 Å

PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1

PDB Compounds: (B:) Inward rectifier potassium channel

SCOPe Domain Sequences for d1xl4b1:

Sequence; same for both SEQRES and ATOM records:

>d1xl4b1 b.1.18.16 (B:139-295) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq

Timeline for d1xl4b1:

• d1xl4b1 first appeared in SCOP 1.71
  
• d1xl4b1 appears in SCOPe 2.07