Lineage for d1xl4a2 (1xl4 A:23-138)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745164Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 745165Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 745166Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 745171Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)
  7. 745172Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (2 PDB entries)
  8. 745173Domain d1xl4a2: 1xl4 A:23-138 [115431]
    Other proteins in same PDB: d1xl4a1, d1xl4b1

Details for d1xl4a2

PDB Entry: 1xl4 (more details), 2.6 Å

PDB Description: Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1
PDB Compounds: (A:) Inward rectifier potassium channel

SCOP Domain Sequences for d1xl4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

SCOP Domain Coordinates for d1xl4a2:

Click to download the PDB-style file with coordinates for d1xl4a2.
(The format of our PDB-style files is described here.)

Timeline for d1xl4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xl4a1