Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species) |
Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (2 PDB entries) Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690 |
Domain d1xl4a1: 1xl4 A:139-299 [115430] Other proteins in same PDB: d1xl4a2, d1xl4b2 complexed with k, mg |
PDB Entry: 1xl4 (more details), 2.6 Å
SCOPe Domain Sequences for d1xl4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xl4a1 b.1.18.16 (A:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh
Timeline for d1xl4a1: