Lineage for d1xkzc_ (1xkz C:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619184Protein Regulatory protein BlaR1 [111289] (1 species)
  7. 2619185Species Staphylococcus aureus [TaxId:1280] [111290] (3 PDB entries)
    Uniprot P18357 338-582 ! Uniprot P18357 334-581 ! Uniprot P18357 338-583
  8. 2619192Domain d1xkzc_: 1xkz C: [115428]
    complexed with caz, epe, so4

Details for d1xkzc_

PDB Entry: 1xkz (more details), 1.75 Å

PDB Description: Crystal structure of the acylated beta-lactam sensor domain of Blar1 from S. aureus
PDB Compounds: (C:) regulatory protein blar1

SCOPe Domain Sequences for d1xkzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkzc_ e.3.1.1 (C:) Regulatory protein BlaR1 {Staphylococcus aureus [TaxId: 1280]}
nykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiylam
fgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatq
lkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllikk
nekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilk
emgvlngq

SCOPe Domain Coordinates for d1xkzc_:

Click to download the PDB-style file with coordinates for d1xkzc_.
(The format of our PDB-style files is described here.)

Timeline for d1xkzc_: