SCOP 1.71: Domain d1xkzc_: 1xkz C:

Lineage for d1xkzc_ (1xkz C:)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)

6. Protein Regulatory protein BlaR1 [111289] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [111290] (3 PDB entries)

8. Domain d1xkzc_: 1xkz C: [115428]

Details for d1xkzc_

PDB Entry: 1xkz, 1.75 Å

PDB Description: Crystal structure of the acylated beta-lactam sensor domain of Blar1 from S. aureus

SCOP Domain Sequences for d1xkzc_:

Sequence; same for both SEQRES and ATOM records:

>d1xkzc_ e.3.1.1 (C:) Regulatory protein BlaR1 {Staphylococcus aureus}
nykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiylam
fgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatq
lkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllikk
nekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilk
emgvlngq

Timeline for d1xkzc_:

• d1xkzc_ is new in SCOP 1.71
  
• d1xkzc_ appears in SCOP 1.73
  
• d1xkzc_ appears in the current release, SCOPe 2.08