![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Regulatory protein BlaR1 [111289] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [111290] (3 PDB entries) Uniprot P18357 338-582 ! Uniprot P18357 334-581 ! Uniprot P18357 338-583 |
![]() | Domain d1xkzc_: 1xkz C: [115428] complexed with caz, epe, so4 |
PDB Entry: 1xkz (more details), 1.75 Å
SCOPe Domain Sequences for d1xkzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkzc_ e.3.1.1 (C:) Regulatory protein BlaR1 {Staphylococcus aureus [TaxId: 1280]} nykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiylam fgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatq lkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllikk nekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilk emgvlngq
Timeline for d1xkzc_: