Lineage for d1xkua_ (1xku A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834895Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 1834896Protein Decorin [117463] (1 species)
  7. 1834897Species Cow (Bos taurus) [TaxId:9913] [117464] (3 PDB entries)
    Uniprot P21793 52-356
  8. 1834898Domain d1xkua_: 1xku A: [115425]
    complexed with nag, trs

Details for d1xkua_

PDB Entry: 1xku (more details), 2.15 Å

PDB Description: crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
PDB Compounds: (A:) Decorin

SCOPe Domain Sequences for d1xkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}
gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
aavql

SCOPe Domain Coordinates for d1xkua_:

Click to download the PDB-style file with coordinates for d1xkua_.
(The format of our PDB-style files is described here.)

Timeline for d1xkua_: