Lineage for d1xktb1 (1xkt B:2218-2502)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135525Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 protein domains)
    Pfam PF00975
  6. 2135535Protein Fatty acid synthase [117709] (1 species)
  7. 2135536Species Human (Homo sapiens) [TaxId:9606] [117710] (1 PDB entry)
    Uniprot P49327 2212-2496
  8. 2135538Domain d1xktb1: 1xkt B:2218-2502 [115424]
    Other proteins in same PDB: d1xkta2, d1xktb2

Details for d1xktb1

PDB Entry: 1xkt (more details), 2.6 Å

PDB Description: Human fatty acid synthase: Structure and substrate selectivity of the thioesterase domain
PDB Compounds: (B:) fatty acid synthase

SCOPe Domain Sequences for d1xktb1:

Sequence, based on SEQRES records: (download)

>d1xktb1 c.69.1.22 (B:2218-2502) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}
nlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqctraa
pldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqqspapthnslflf
dgsptyvlaytqsyrakltpgceaeaeteaicffvqqftdmehnrvleallplkgleerv
aaavdliikshqgldrqelsfaarsfyyklraaeqytpkakyygnvmllraktggayged
lgadynlsqvcdgkvsvhviegdhrtllegsglesiisiihssla

Sequence, based on observed residues (ATOM records): (download)

>d1xktb1 c.69.1.22 (B:2218-2502) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}
nlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqctraa
pldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqhnslflfdgspty
pgceaeaeteaicffvqqftdmehnrvleallplkgleervaaavdliikshqgldrqel
sfaarsfyyklraaeqytpkakyygnvmllraktglgadynlsqvcdgkvsvhviegdhr
tllesglesiisiihssla

SCOPe Domain Coordinates for d1xktb1:

Click to download the PDB-style file with coordinates for d1xktb1.
(The format of our PDB-style files is described here.)

Timeline for d1xktb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xktb2