Lineage for d1xkta_ (1xkt A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590751Family c.69.1.22: Thioesterase domain of polypeptide, polyketide and fatty acid synthases [69584] (4 proteins)
    Pfam 00975
  6. 590759Protein Fatty acid synthase [117709] (1 species)
  7. 590760Species Human (Homo sapiens) [TaxId:9606] [117710] (1 PDB entry)
  8. 590761Domain d1xkta_: 1xkt A: [115423]

Details for d1xkta_

PDB Entry: 1xkt (more details), 2.6 Å

PDB Description: Human fatty acid synthase: Structure and substrate selectivity of the thioesterase domain

SCOP Domain Sequences for d1xkta_:

Sequence, based on SEQRES records: (download)

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens)}
vnlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqctra
apldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqqspapthnslfl
fdgsptyvlaytqsyrakltpgceaeaeteaicffvqqftdmehnrvleallplkgleer
vaaavdliikshqgldrqelsfaarsfyyklraaeqytpkakyygnvmllraktggayge
dlgadynlsqvcdgkvsvhviegdhrtllegsglesiisiihssla

Sequence, based on observed residues (ATOM records): (download)

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens)}
vnlrsllvnpegptlmrlnsvqsserplflvhpiegsttvfhslasrlsiptyglqctra
apldsihslaayyidcirqvqpegpyrvagysygacvafemcsqlqaqhnslflfdgspt
ypgceaeaeteaicffvqqftdmehnrvleallplkgleervaaavdliikshqgldrqe
lsfaarsfyyklraaeqytpkakyygnvmllraktglgadynlsqvcdgkvsvhviegdh
rtllesglesiisiihssla

SCOP Domain Coordinates for d1xkta_:

Click to download the PDB-style file with coordinates for d1xkta_.
(The format of our PDB-style files is described here.)

Timeline for d1xkta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xktb_