Lineage for d1xksa_ (1xks A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066522Superfamily b.69.14: Nucleoporin domain [117289] (1 family) (S)
  5. 2066523Family b.69.14.1: Nucleoporin domain [117290] (2 protein domains)
  6. 2066524Protein Nuclear pore complex protein Nup133 [117291] (1 species)
  7. 2066525Species Human (Homo sapiens) [TaxId:9606] [117292] (1 PDB entry)
    Uniprot Q8WUM0 75-477
  8. 2066526Domain d1xksa_: 1xks A: [115422]

Details for d1xksa_

PDB Entry: 1xks (more details), 2.35 Å

PDB Description: The crystal structure of the N-terminal domain of Nup133 reveals a beta-propeller fold common to several nucleoporins
PDB Compounds: (A:) Nuclear pore complex protein Nup133

SCOPe Domain Sequences for d1xksa_:

Sequence, based on SEQRES records: (download)

>d1xksa_ b.69.14.1 (A:) Nuclear pore complex protein Nup133 {Human (Homo sapiens) [TaxId: 9606]}
esvnydvktfgsslpvkvmealtlaevddqltinideggwaclvckekliiwkialspit
klsvckelqlppsdfhwsadlvalsysspsgeahstqavavmvatregsirywpslaged
tyteafvdsggdktysfltavqggsfilsssgsqlirlipessgkihqhilpqgqgmlsg
igrkvsslfgilspssdltlssvlwdrerssfysltssniskwelddssekhayswdinr
alkenitdaiwgsesnyeaikegvniryldlkqncdglvilaaawhsadnpcliyyslit
iedngcqmsdavtvevtqynppfqsedlilcqltvpnfsnqtaylynesavyvcstgtgk
fslpqekivfnaqgdsvlgagacggvpiifsrnsglvsitsre

Sequence, based on observed residues (ATOM records): (download)

>d1xksa_ b.69.14.1 (A:) Nuclear pore complex protein Nup133 {Human (Homo sapiens) [TaxId: 9606]}
esvnydvktfgsslpvkvmealtlaevddqltinideggwaclvckekliiwkialspit
klsvckelqlppsdfhwsadlvalsysstqavavmvatregsirywpslagedtyteafv
dktysfltavqggsfilsssgsqlirlipessgkihqhilpqgqgmsdltlssvlwdrer
ssfysltssniskwelddssekhayswdinralkenitdaiwgsesnyeaikegvniryl
dlkqncdglvilaaawhsadnpcliyyslitiedngcqmsdavtvevtqynppfqsedli
lcqltvpnfsnqtaylynesavyvcstgtgkfslpqekivfnaqgdsvlgagacggvpii
fsrnsglvsitsre

SCOPe Domain Coordinates for d1xksa_:

Click to download the PDB-style file with coordinates for d1xksa_.
(The format of our PDB-style files is described here.)

Timeline for d1xksa_: