SCOPe 2.08: Domain d1xkra_: 1xkr A:

Lineage for d1xkra_ (1xkr A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.252: CheC-like [103038] (1 superfamily)
   duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs

4. Superfamily d.252.1: CheC-like [103039] (1 family)

5. Family d.252.1.1: CheC-like [103040] (3 proteins)
   Pfam PF04509

6. Protein Chemotaxis protein CheC [118005] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [118006] (1 PDB entry)
   Uniprot Q9X006 # TM0904

8. Domain d1xkra_: 1xkr A: [115421]

Details for d1xkra_

PDB Entry: 1xkr, 1.75 Å

PDB Description: X-ray Structure of Thermotoga maritima CheC

PDB Compounds: (A:) chemotaxis protein CheC

SCOPe Domain Sequences for d1xkra_:

Sequence; same for both SEQRES and ATOM records:

>d1xkra_ d.252.1.1 (A:) Chemotaxis protein CheC {Thermotoga maritima [TaxId: 2336]}
hmkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeei
vvgvkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcg
tyvsaladflgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveeeee
pltsymmmipkpgylvkifermgiq

Timeline for d1xkra_:

• d1xkra_ first appeared in SCOP 1.71
  
• d1xkra_ appears in SCOPe 2.07