Lineage for d1xkra_ (1xkr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008848Fold d.252: CheC-like [103038] (1 superfamily)
    duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs
  4. 3008849Superfamily d.252.1: CheC-like [103039] (1 family) (S)
  5. 3008850Family d.252.1.1: CheC-like [103040] (3 proteins)
    Pfam PF04509
  6. 3008851Protein Chemotaxis protein CheC [118005] (1 species)
  7. 3008852Species Thermotoga maritima [TaxId:2336] [118006] (1 PDB entry)
    Uniprot Q9X006 # TM0904
  8. 3008853Domain d1xkra_: 1xkr A: [115421]

Details for d1xkra_

PDB Entry: 1xkr (more details), 1.75 Å

PDB Description: X-ray Structure of Thermotoga maritima CheC
PDB Compounds: (A:) chemotaxis protein CheC

SCOPe Domain Sequences for d1xkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkra_ d.252.1.1 (A:) Chemotaxis protein CheC {Thermotoga maritima [TaxId: 2336]}
hmkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeei
vvgvkmpvtgdiegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcg
tyvsaladflgfkidtlppqlvidmisaifaeasieelednsedqivfvetllkveeeee
pltsymmmipkpgylvkifermgiq

SCOPe Domain Coordinates for d1xkra_:

Click to download the PDB-style file with coordinates for d1xkra_.
(The format of our PDB-style files is described here.)

Timeline for d1xkra_: