Lineage for d1xkqd_ (1xkq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842602Protein Hypothetical protein R05D8.7 [117415] (1 species)
  7. 2842603Species Nematode (Caenorhabditis elegans) [TaxId:6239] [117416] (1 PDB entry)
    Uniprot Q9N5G4
  8. 2842607Domain d1xkqd_: 1xkq D: [115420]
    complexed with ndp

Details for d1xkqd_

PDB Entry: 1xkq (more details), 2.1 Å

PDB Description: Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
PDB Compounds: (D:) short-chain reductase family member (5D234)

SCOPe Domain Sequences for d1xkqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkqd_ c.2.1.2 (D:) Hypothetical protein R05D8.7 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn
svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln
lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla
kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf
ladrnlsfyilgqsivadggtslvmgtqahd

SCOPe Domain Coordinates for d1xkqd_:

Click to download the PDB-style file with coordinates for d1xkqd_.
(The format of our PDB-style files is described here.)

Timeline for d1xkqd_: