Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Hypothetical protein R05D8.7 [117415] (1 species) |
Species Caenorhabditis elegans [TaxId:6239] [117416] (1 PDB entry) Uniprot Q9N5G4 |
Domain d1xkqc_: 1xkq C: [115419] |
PDB Entry: 1xkq (more details), 2.1 Å
SCOP Domain Sequences for d1xkqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkqc_ c.2.1.2 (C:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf ladrnlsfyilgqsivadggtslvmgtqahd
Timeline for d1xkqc_: