Lineage for d1xkqa_ (1xkq A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686939Protein Hypothetical protein R05D8.7 [117415] (1 species)
  7. 686940Species Caenorhabditis elegans [TaxId:6239] [117416] (1 PDB entry)
  8. 686941Domain d1xkqa_: 1xkq A: [115417]

Details for d1xkqa_

PDB Entry: 1xkq (more details), 2.1 Å

PDB Description: Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
PDB Compounds: (A:) short-chain reductase family member (5D234)

SCOP Domain Sequences for d1xkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}
prfsnktviitgssngigrttailfaqeganvtitgrsserleetrqiilksgvsekqvn
svvadvttedgqdqiinstlkqfgkidvlvnnagaaipdafgttgtdqgidiyhktlkln
lqaviemtkkvkphlvaskgeivnvssivagpqaqpdflyyaiakaaldqytrstaidla
kfgirvnsvspgmvetgftnamgmpdqasqkfynfmashkecipigaagkpehianiilf
ladrnlsfyilgqsivadggtslvmgtqahdv

SCOP Domain Coordinates for d1xkqa_:

Click to download the PDB-style file with coordinates for d1xkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1xkqa_: