Lineage for d1xkob_ (1xko B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616866Fold d.252: CheC-like [103038] (1 superfamily)
    duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs
  4. 616867Superfamily d.252.1: CheC-like [103039] (1 family) (S)
  5. 616868Family d.252.1.1: CheC-like [103040] (2 proteins)
    Pfam 04509
  6. 616872Protein Chemotaxis protein CheX [103041] (1 species)
  7. 616873Species Thermotoga maritima [TaxId:243274] [103042] (2 PDB entries)
    TM1618
  8. 616875Domain d1xkob_: 1xko B: [115416]

Details for d1xkob_

PDB Entry: 1xko (more details), 2.48 Å

PDB Description: Structure of Thermotoga maritima CheX

SCOP Domain Sequences for d1xkob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkob_ d.252.1.1 (B:) Chemotaxis protein CheX {Thermotoga maritima}
gshmmdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsl
iysfssetalkvvsammggmeynqldelalsaigelgnmtagklamklehlgkhvditpp
tvvsgrdlkiksfgvilklpisvfseedfdlhlsvksgg

SCOP Domain Coordinates for d1xkob_:

Click to download the PDB-style file with coordinates for d1xkob_.
(The format of our PDB-style files is described here.)

Timeline for d1xkob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xkoa_