SCOPe 2.08: Domain d1xkob1: 1xko B:1-155

Lineage for d1xkob1 (1xko B:1-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.252: CheC-like [103038] (1 superfamily)
   duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs

4. Superfamily d.252.1: CheC-like [103039] (1 family)

5. Family d.252.1.1: CheC-like [103040] (3 proteins)
   Pfam PF04509

6. Protein Chemotaxis protein CheX [103041] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [103042] (2 PDB entries)
   Uniprot Q9X1V3
   TM1618

8. Domain d1xkob1: 1xko B:1-155 [115416]
   Other proteins in same PDB: d1xkoa2, d1xkob2

Details for d1xkob1

PDB Entry: 1xko, 2.48 Å

PDB Description: Structure of Thermotoga maritima CheX

PDB Compounds: (B:) CHEMOTAXIS protein cheX

SCOPe Domain Sequences for d1xkob1:

Sequence; same for both SEQRES and ATOM records:

>d1xkob1 d.252.1.1 (B:1-155) Chemotaxis protein CheX {Thermotoga maritima [TaxId: 2336]}
mdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsliysf
ssetalkvvsammggmeynqldelalsaigelgnmtagklamklehlgkhvditpptvvs
grdlkiksfgvilklpisvfseedfdlhlsvksgg

Timeline for d1xkob1:

• d1xkob1 first appeared in SCOP 1.71, called d1xkob_
  
• d1xkob1 appears in SCOPe 2.07