Lineage for d1xkoa1 (1xko A:1-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008848Fold d.252: CheC-like [103038] (1 superfamily)
    duplication: tandem repeat of two intertwined alpha-beta-(X)-beta(2) motifs
  4. 3008849Superfamily d.252.1: CheC-like [103039] (1 family) (S)
  5. 3008850Family d.252.1.1: CheC-like [103040] (3 proteins)
    Pfam PF04509
  6. 3008854Protein Chemotaxis protein CheX [103041] (1 species)
  7. 3008855Species Thermotoga maritima [TaxId:2336] [103042] (2 PDB entries)
    Uniprot Q9X1V3
    TM1618
  8. 3008856Domain d1xkoa1: 1xko A:1-152 [115415]
    Other proteins in same PDB: d1xkoa2, d1xkob2

Details for d1xkoa1

PDB Entry: 1xko (more details), 2.48 Å

PDB Description: Structure of Thermotoga maritima CheX
PDB Compounds: (A:) CHEMOTAXIS protein cheX

SCOPe Domain Sequences for d1xkoa1:

Sequence, based on SEQRES records: (download)

>d1xkoa1 d.252.1.1 (A:1-152) Chemotaxis protein CheX {Thermotoga maritima [TaxId: 2336]}
mdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsliysf
ssetalkvvsammggmeynqldelalsaigelgnmtagklamklehlgkhvditpptvvs
grdlkiksfgvilklpisvfseedfdlhlsvk

Sequence, based on observed residues (ATOM records): (download)

>d1xkoa1 d.252.1.1 (A:1-152) Chemotaxis protein CheX {Thermotoga maritima [TaxId: 2336]}
mdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsliysf
ssetalkvvsammggmeynqldelalsaigelgnmtagklamklehhvditpptvvsgrd
lkiksfgvilklpisvfseedfdlhlsvk

SCOPe Domain Coordinates for d1xkoa1:

Click to download the PDB-style file with coordinates for d1xkoa1.
(The format of our PDB-style files is described here.)

Timeline for d1xkoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkoa2