Lineage for d1xkna1 (1xkn A:2-347)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213889Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2213905Protein Putative peptidyl-arginine deiminase [111158] (3 species)
  7. 2213906Species Chlorobium tepidum [TaxId:1097] [118089] (1 PDB entry)
    Uniprot Q8KCB6
  8. 2213907Domain d1xkna1: 1xkn A:2-347 [115414]
    Other proteins in same PDB: d1xkna2
    Structural genomics target
    complexed with cl, na

Details for d1xkna1

PDB Entry: 1xkn (more details), 1.6 Å

PDB Description: crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21
PDB Compounds: (A:) putative peptidyl-arginine deiminase

SCOPe Domain Sequences for d1xkna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkna1 d.126.1.6 (A:2-347) Putative peptidyl-arginine deiminase {Chlorobium tepidum [TaxId: 1097]}
septyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldda
meaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnweyn
awggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnrn
pslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedpede
nykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpty
rcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepam

SCOPe Domain Coordinates for d1xkna1:

Click to download the PDB-style file with coordinates for d1xkna1.
(The format of our PDB-style files is described here.)

Timeline for d1xkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkna2