SCOP 1.73: Domain d1xkna_: 1xkn A:

Lineage for d1xkna_ (1xkn A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (7 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein Putative peptidyl-arginine deiminase [111158] (3 species)

7. Species Chlorobium tepidum [TaxId:1097] [118089] (1 PDB entry)

8. Domain d1xkna_: 1xkn A: [115414]
   Structural genomics target
   complexed with cl, na

Details for d1xkna_

PDB Entry: 1xkn, 1.6 Å

PDB Description: crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21

PDB Compounds: (A:) putative peptidyl-arginine deiminase

SCOP Domain Sequences for d1xkna_:

Sequence; same for both SEQRES and ATOM records:

>d1xkna_ d.126.1.6 (A:) Putative peptidyl-arginine deiminase {Chlorobium tepidum [TaxId: 1097]}
septyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldda
meaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnweyn
awggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnrn
pslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedpede
nykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpty
rcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepamlehhhhh

Timeline for d1xkna_:

• d1xkna_ first appeared in SCOP 1.71
  
• d1xkna_ appears in SCOP 1.75
  
• d1xkna_ appears in the current release, SCOPe 2.08, called d1xkna1