Lineage for d1xkna_ (1xkn A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610438Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 610439Superfamily d.126.1: Pentein [55909] (6 families) (S)
  5. 610487Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (2 proteins)
    Pfam 04371; functionally related to the amidinotransferase, similar active site
  6. 610492Protein Putative peptidyl-arginine deiminase [111158] (2 species)
  7. 610493Species Chlorobium tepidum [TaxId:1097] [118089] (1 PDB entry)
  8. 610494Domain d1xkna_: 1xkn A: [115414]
    Structural genomics target
    complexed with cl, na

Details for d1xkna_

PDB Entry: 1xkn (more details), 1.6 Å

PDB Description: crystal structure of the putative peptidyl-arginine deiminase from chlorobium tepidum, nesg target ctr21

SCOP Domain Sequences for d1xkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkna_ d.126.1.6 (A:) Putative peptidyl-arginine deiminase {Chlorobium tepidum}
septyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvldda
meaqarellkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnweyn
awggkyepydddnavpervakaqglpmvstgmvleggaidvngagllltttacllnpnrn
pslgkaeieaqlrrylgiekvlwlgdgiagddtdghvddmarfvnentvviaveedpede
nykplrenyellktmtgldgkplnivklpmpepvyydgerlpasyanfyiantvvlvpty
rcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepamlehhhhh

SCOP Domain Coordinates for d1xkna_:

Click to download the PDB-style file with coordinates for d1xkna_.
(The format of our PDB-style files is described here.)

Timeline for d1xkna_: