Lineage for d1xklb_ (1xkl B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003485Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
  6. 1003522Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)
  7. 1003523Species Tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)
    Uniprot Q6RYA0
  8. 1003525Domain d1xklb_: 1xkl B: [115411]
    Structural genomics target
    complexed with sth

Details for d1xklb_

PDB Entry: 1xkl (more details), 2 Å

PDB Description: crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241
PDB Compounds: (B:) salicylic acid-binding protein 2

SCOPe Domain Sequences for d1xklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xklb_ c.69.1.20 (B:) Salicylic acid-binding protein 2 (SABP2) {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
cepqklcaslleiahk

SCOPe Domain Coordinates for d1xklb_:

Click to download the PDB-style file with coordinates for d1xklb_.
(The format of our PDB-style files is described here.)

Timeline for d1xklb_: