Lineage for d1xklb_ (1xkl B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590684Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)
  6. 590714Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)
  7. 590715Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)
  8. 590717Domain d1xklb_: 1xkl B: [115411]

Details for d1xklb_

PDB Entry: 1xkl (more details), 2 Å

PDB Description: crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241

SCOP Domain Sequences for d1xklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xklb_ c.69.1.20 (B:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum)}
egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
cepqklcaslleiahk

SCOP Domain Coordinates for d1xklb_:

Click to download the PDB-style file with coordinates for d1xklb_.
(The format of our PDB-style files is described here.)

Timeline for d1xklb_: