SCOP 1.71: Domain d1xklb_: 1xkl B:

Lineage for d1xklb_ (1xkl B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)

6. Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species)

7. Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries)

8. Domain d1xklb_: 1xkl B: [115411]

Details for d1xklb_

PDB Entry: 1xkl, 2 Å

PDB Description: crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241

SCOP Domain Sequences for d1xklb_:

Sequence; same for both SEQRES and ATOM records:

>d1xklb_ c.69.1.20 (B:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum)}
egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl
melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy
nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf
medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml
cepqklcaslleiahk

Timeline for d1xklb_:

• d1xklb_ is new in SCOP 1.71
  
• d1xklb_ appears in SCOP 1.73
  
• d1xklb_ appears in the current release, SCOPe 2.08