Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins) |
Protein Salicylic acid-binding protein 2 (SABP2) [117707] (1 species) |
Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [117708] (3 PDB entries) |
Domain d1xkla_: 1xkl A: [115410] |
PDB Entry: 1xkl (more details), 2 Å
SCOP Domain Sequences for d1xkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} egkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlpl melmeslsadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqy nertpaenwldtqflpygspeepltsmffgpkflahklyqlcspedlalasslvrpsslf medlskakyftderfgsvkrvyivctedkgipeefqrwqidnigvteaieikgadhmaml cepqklcaslleiahkyn
Timeline for d1xkla_: