![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82796] (129 PDB entries) Uniprot P00533 702-1018 |
![]() | Domain d1xkka_: 1xkk A: [115409] complexed with fmm, po4 |
PDB Entry: 1xkk (more details), 2.4 Å
SCOPe Domain Sequences for d1xkka_:
Sequence, based on SEQRES records: (download)
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} allrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeild eayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqi akgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwm alesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppicti dvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyral mdeedmddvvdadeyli
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} allrilketefkkikvlgsgafgtvykglwipvkipvaikelrekankeildeayvmasv dnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyle drrlvhrdlaarnvlvktpqhvkitdfglakllgaeekvpikwmalesilhriythqsdv wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidads rpkfreliiefskmardpqrylviqgdermsnfyralmdevvdadeyli
Timeline for d1xkka_: