SCOPe 2.03: Domain d1xkia_: 1xki A:

Lineage for d1xkia_ (1xki A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117266] (2 PDB entries)
   Uniprot P31025 30-168

8. Domain d1xkia_: 1xki A: [115408]
   complexed with cl, zn

Details for d1xkia_

PDB Entry: 1xki, 1.8 Å

PDB Description: crystal structure of human tear lipocalin/von ebners gland protein

PDB Compounds: (A:) Von Ebner's gland protein

SCOPe Domain Sequences for d1xkia_:

Sequence, based on SEQRES records:

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlekt
depgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfe
kaagarglstesiliprqs

Sequence, based on observed residues (ATOM records):

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvnlesvtpmtlttleggnleakvtmsgrcqevkavlektdepgkytad
ggkhvayiirshvkdhyifysegegkpvrgvklvgrdpknnlealedfekaagarglste
siliprqs

Timeline for d1xkia_:

• d1xkia_ first appeared in SCOP 1.71
  
• d1xkia_ appears in SCOPe 2.02
  
• d1xkia_ appears in SCOPe 2.04
  
• d1xkia_ appears in the current release, SCOPe 2.08