Lineage for d1xkia_ (1xki A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324579Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species)
  7. 1324580Species Human (Homo sapiens) [TaxId:9606] [117266] (2 PDB entries)
    Uniprot P31025 30-168
  8. 1324581Domain d1xkia_: 1xki A: [115408]
    complexed with cl, zn

Details for d1xkia_

PDB Entry: 1xki (more details), 1.8 Å

PDB Description: crystal structure of human tear lipocalin/von ebners gland protein
PDB Compounds: (A:) Von Ebner's gland protein

SCOPe Domain Sequences for d1xkia_:

Sequence, based on SEQRES records: (download)

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlekt
depgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfe
kaagarglstesiliprqs

Sequence, based on observed residues (ATOM records): (download)

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvnlesvtpmtlttleggnleakvtmsgrcqevkavlektdepgkytad
ggkhvayiirshvkdhyifysegegkpvrgvklvgrdpknnlealedfekaagarglste
siliprqs

SCOPe Domain Coordinates for d1xkia_:

Click to download the PDB-style file with coordinates for d1xkia_.
(The format of our PDB-style files is described here.)

Timeline for d1xkia_: