Lineage for d1xkia_ (1xki A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673921Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species)
  7. 673922Species Human (Homo sapiens) [TaxId:9606] [117266] (1 PDB entry)
  8. 673923Domain d1xkia_: 1xki A: [115408]
    complexed with cl, zn; mutant

Details for d1xkia_

PDB Entry: 1xki (more details), 1.8 Å

PDB Description: crystal structure of human tear lipocalin/von ebners gland protein
PDB Compounds: (A:) Von Ebner's gland protein

SCOP Domain Sequences for d1xkia_:

Sequence, based on SEQRES records: (download)

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlekt
depgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfe
kaagarglstesiliprqs

Sequence, based on observed residues (ATOM records): (download)

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvnlesvtpmtlttleggnleakvtmsgrcqevkavlektdepgkytad
ggkhvayiirshvkdhyifysegegkpvrgvklvgrdpknnlealedfekaagarglste
siliprqs

SCOP Domain Coordinates for d1xkia_:

Click to download the PDB-style file with coordinates for d1xkia_.
(The format of our PDB-style files is described here.)

Timeline for d1xkia_: