Lineage for d1xk8f_ (1xk8 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950805Protein Mammalian CutA-like protein [102975] (2 species)
  7. 2950806Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
    Uniprot O60888 40-146
  8. 2950818Domain d1xk8f_: 1xk8 F: [115407]
    Structural genomics target
    complexed with na

Details for d1xk8f_

PDB Entry: 1xk8 (more details), 2.7 Å

PDB Description: divalent cation tolerant protein cuta from homo sapiens o60888
PDB Compounds: (F:) Divalent cation tolerant protein CUTA

SCOPe Domain Sequences for d1xk8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk8f_ d.58.5.2 (F:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte

SCOPe Domain Coordinates for d1xk8f_:

Click to download the PDB-style file with coordinates for d1xk8f_.
(The format of our PDB-style files is described here.)

Timeline for d1xk8f_: