SCOP 1.71: Domain d1xk8e_: 1xk8 E:

Lineage for d1xk8e_ (1xk8 E:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Mammalian CutA-like protein [102975] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117946] (1 PDB entry)

8. Domain d1xk8e_: 1xk8 E: [115406]

Details for d1xk8e_

PDB Entry: 1xk8, 2.7 Å

PDB Description: divalent cation tolerant protein cuta from homo sapiens o60888

SCOP Domain Sequences for d1xk8e_:

Sequence; same for both SEQRES and ATOM records:

>d1xk8e_ d.58.5.2 (E:) Mammalian CutA-like protein {Human (Homo sapiens)}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte

Timeline for d1xk8e_:

• d1xk8e_ is new in SCOP 1.71
  
• d1xk8e_ appears in SCOP 1.73
  
• d1xk8e_ appears in the current release, SCOPe 2.08